Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KMO Peptide - middle region

KMO Peptide - middle region

Product Specifications

Product Name Alternative

AI046660

UniProt

Q91WN4

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_598570.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QGMNAGFEDCLVFDELMDKFNNNLSMCLPEFSRFRIPDDHAISDLSMYNY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zea Mays Casein Kinase 2 alpha (ZMCK2a) Protein
abx073023-01 3 µg

Zea Mays Casein Kinase 2 alpha (ZMCK2a) Protein

Sign In for Pricing
View Details
Zea Mays Casein Kinase 2 alpha (ZMCK2a) Protein
abx073023-02 10 µg

Zea Mays Casein Kinase 2 alpha (ZMCK2a) Protein

Sign In for Pricing
View Details
Zea Mays Casein Kinase 2 alpha (ZMCK2a) Protein
abx073023-03 20 µg

Zea Mays Casein Kinase 2 alpha (ZMCK2a) Protein

Sign In for Pricing
View Details
HSP60 (HSPD1/780), CF568 conjugate, 0.1mg/mL
BNC680780-500 1x 500 µL

HSP60 (HSPD1/780), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Itgal Antibody (PE/Cy7)
orb1251785 0.1 mg

Itgal Antibody (PE/Cy7)

Sign In for Pricing
View Details
Oxaliplatin - Bio-X TM
BO164182 10 mg

Oxaliplatin - Bio-X TM

Sign In for Pricing
View Details