Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KMO Peptide - middle region

KMO Peptide - middle region

Product Specifications

Product Name Alternative

AI046660

UniProt

Q91WN4

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_598570.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QGMNAGFEDCLVFDELMDKFNNNLSMCLPEFSRFRIPDDHAISDLSMYNY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Sulfhydryl oxidase 1 (QSOX1) ELISA Kit
YLA1552RA-01 48 Tests

Rat Sulfhydryl oxidase 1 (QSOX1) ELISA Kit

Sign In for Pricing
View Details
Rat Sulfhydryl oxidase 1 (QSOX1) ELISA Kit
YLA1552RA-02 96 Tests

Rat Sulfhydryl oxidase 1 (QSOX1) ELISA Kit

Sign In for Pricing
View Details
MSN Polyclonal Antibody
E912463 100 µL

MSN Polyclonal Antibody

Sign In for Pricing
View Details
KCNK6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1122508 1.0 µg DNA

KCNK6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
GLCE Antibody, HRP conjugated
A23243-100UG 100 µg

GLCE Antibody, HRP conjugated

Sign In for Pricing
View Details
MUM1 Protein Vector (Rat) (pPM-C-His)
PV283729 500 ng

MUM1 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details