Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GCLC Peptide - middle region

GCLC Peptide - middle region

Product Specifications

Product Name Alternative

Glclc, GLCL-H, Ggcs-hs, D9Wsu168e

UniProt

P97494

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_034425.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HFENIQSTNWQTMRFKPPPPNSDIGWRVEFRPMEVQLTDFENSAYVVFVV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDE2A Rabbit Polyclonal Antibody
orb2952601-01 50 µg

PDE2A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PDE2A Rabbit Polyclonal Antibody
orb2952601-02 100 µg

PDE2A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ABCG2 Rabbit Polyclonal Antibody
TA373150 100 µL

ABCG2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mcat sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3571003 1.0 µg DNA

Mcat sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Epstein-Barr Virus EA IgG ELISA Kit
ESR1363G 1 Each

Epstein-Barr Virus EA IgG ELISA Kit

Sign In for Pricing
View Details
Rat Irgc Pre-designed siRNA Set B
SI206868B 1 Each

Rat Irgc Pre-designed siRNA Set B

Sign In for Pricing
View Details