Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GCLC Peptide - middle region

GCLC Peptide - middle region

Product Specifications

Product Name Alternative

Glclc, GLCL-H, Ggcs-hs, D9Wsu168e

UniProt

P97494

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_034425.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HFENIQSTNWQTMRFKPPPPNSDIGWRVEFRPMEVQLTDFENSAYVVFVV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCTD6 ORF Vector (Human) (pORF)
25456011 1.0 µg DNA

KCTD6 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
pEGFP-Linker-IL17A Plasmid
PVT10177 2 µg

pEGFP-Linker-IL17A Plasmid

Sign In for Pricing
View Details
Electrode Plates For Simple Cells
1090360/1 1 Each

Electrode Plates For Simple Cells

Sign In for Pricing
View Details
Non-Fat Powder Milk
D8340-01 10 g

Non-Fat Powder Milk

Sign In for Pricing
View Details
Non-Fat Powder Milk
D8340-02 100 g

Non-Fat Powder Milk

Sign In for Pricing
View Details
Non-Fat Powder Milk
D8340-03 500 g

Non-Fat Powder Milk

Sign In for Pricing
View Details