Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDA Peptide - C-terminal region

GDA Peptide - C-terminal region

Product Specifications

Product Name Alternative

GAH, AU015411, AW047581

UniProt

Q9R111

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_034396.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SDSPIDLFYGDFVGDISEAVIQKFLYLGDDRNIEEVYVGGKQVVPFSSSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP28 Human Gene Knockout Kit (CRISPR)
KN415325 1 Kit

MMP28 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Chromogranin A (LK2H10 + PHE5 + CGA414), CF594 conjugate, 0.1mg/mL
BNC941223-500 1x 500 µL

Chromogranin A (LK2H10 + PHE5 + CGA414), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZNF321P (NM_203307) Human Over-expression Lysate
LC404389 20 µg

ZNF321P (NM_203307) Human Over-expression Lysate

Sign In for Pricing
View Details
Prolactin Receptor (hPRL Receptor) (rPRLR/742), CF405S conjugate, 0.1mg/mL
BNC043784-100 1x 100 µL

Prolactin Receptor (hPRL Receptor) (rPRLR/742), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS803120 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Biotin Conjugated Lens culinaris Lectin (Lentil) -LcH-
BA-1401-5 5 mg

Biotin Conjugated Lens culinaris Lectin (Lentil) -LcH-

Sign In for Pricing
View Details