Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDA Peptide - C-terminal region

GDA Peptide - C-terminal region

Product Specifications

Product Name Alternative

GAH, AU015411, AW047581

UniProt

Q9R111

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_034396.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SDSPIDLFYGDFVGDISEAVIQKFLYLGDDRNIEEVYVGGKQVVPFSSSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LSM1 Antibody
KC-30265-01 50 μL

LSM1 Antibody

Sign In for Pricing
View Details
LSM1 Antibody
KC-30265-02 100 µL

LSM1 Antibody

Sign In for Pricing
View Details
LSM1 Antibody
KC-30265-03 1 mL

LSM1 Antibody

Sign In for Pricing
View Details
Mouse Taldo1 activation kit by CRISPRa
GA204206 1 Kit

Mouse Taldo1 activation kit by CRISPRa

Sign In for Pricing
View Details
Human SEMA4C activation kit by CRISPRa
GA110363 1 Kit

Human SEMA4C activation kit by CRISPRa

Sign In for Pricing
View Details
Human Membralin (TMEM259) activation kit by CRISPRa
GA114102 1 Kit

Human Membralin (TMEM259) activation kit by CRISPRa

Sign In for Pricing
View Details