Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOA4 Peptide - N-terminal region

APOA4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Apoa-4

UniProt

P06728

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_031494.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YFTQLSNNAKEAVEQFQKTDVTQQLSTLFQDKLGDASTYADGVHNKLVPF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat anti Human IgG Fc
20-S1211G000-G4 10 mL

Goat anti Human IgG Fc

Sign In for Pricing
View Details
KIF1-binding protein Overexpression Lysate (Native) - (Dry Ice)
NBP2-07140 0.1 mg

KIF1-binding protein Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
WDR1 (NM_017491) Human Tagged Lenti ORF Clone
RC200303L3 10 µg

WDR1 (NM_017491) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human Glutathione S Transferase Alpha 4 (GSTa4) ELISA Kit
DLR-GSTa4-Hu-96T 96 Tests

Human Glutathione S Transferase Alpha 4 (GSTa4) ELISA Kit

Sign In for Pricing
View Details
DNAJC25 (NM_001015882) Human Tagged ORF Clone
RC208426 10 µg

DNAJC25 (NM_001015882) Human Tagged ORF Clone

Sign In for Pricing
View Details
Pde6d sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6616506 1.0 µg DNA

Pde6d sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details