Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOA4 Peptide - N-terminal region

APOA4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Apoa-4

UniProt

P06728

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_031494.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YFTQLSNNAKEAVEQFQKTDVTQQLSTLFQDKLGDASTYADGVHNKLVPF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Dickkopf Related Protein 4 (DKK4) ELISA Kit
RD-DKK4-Mu-96Tests 96 Tests

Mouse Dickkopf Related Protein 4 (DKK4) ELISA Kit

Sign In for Pricing
View Details
MERTK Conjugated Antibody
MBS9443940-01 0.1 mL (Biotin)

MERTK Conjugated Antibody

Sign In for Pricing
View Details
MERTK Conjugated Antibody
MBS9443940-02 0.1 mL (AF350)

MERTK Conjugated Antibody

Sign In for Pricing
View Details
MERTK Conjugated Antibody
MBS9443940-03 0.1 mL (AF405)

MERTK Conjugated Antibody

Sign In for Pricing
View Details
MERTK Conjugated Antibody
MBS9443940-04 0.1 mL (AF488)

MERTK Conjugated Antibody

Sign In for Pricing
View Details
MERTK Conjugated Antibody
MBS9443940-05 0.1 mL (AF555)

MERTK Conjugated Antibody

Sign In for Pricing
View Details