PDZK1 Peptide - middle region
PDZK1 Peptide - middle region
Product Specifications
Product Name Alternative
Pdzd1, mPDZK1, AI267131, AI314638, AL022680, D3Ertd537e, 1700023D20Rik, 2610507N21Rik, 4921513F16Rik
UniProt
Q9JIL4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001139473.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EEVVEKVTKSGSRIMFLLVDKETARCHSEQKTQFKRETASLKLLPHQPRV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K6367404 1.0 µg DNA
Arl4d sgRNA CRISPR Lentivector (Rat) (Target 3)
Sign In for Pricing
View Details 
MBS1442366-01 0.5 mg (E-Coli)
Recombinant Xanthomonas axonopodis pv. citri ATP synthase subunit b (atpF), partial
Sign In for Pricing
View Details MBS1442366-02 0.05 mg (Baculovirus)
Recombinant Xanthomonas axonopodis pv. citri ATP synthase subunit b (atpF), partial
Sign In for Pricing
View Details MBS1442366-03 0.5 mg (Yeast)
Recombinant Xanthomonas axonopodis pv. citri ATP synthase subunit b (atpF), partial
Sign In for Pricing
View Details MBS1442366-04 0.05 mg (Mammalian-Cell)
Recombinant Xanthomonas axonopodis pv. citri ATP synthase subunit b (atpF), partial
Sign In for Pricing
View Details MBS1442366-05 1 mg (E-Coli)
Recombinant Xanthomonas axonopodis pv. citri ATP synthase subunit b (atpF), partial
Sign In for Pricing
View Details