Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBX20 Peptide - middle region

TBX20 Peptide - middle region

Product Specifications

Product Name Alternative

Tbx12, AL022859, 9430010M06Rik

UniProt

Q9ES03

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001192014.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LMDIVPVDNKRYRYAYHRSSWLVAGKADPPLPARLYVHPDSPFTGEQLLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUDT12 Mouse Monoclonal Antibody [Clone ID: OTI1A2]
CF805547 100 µg

NUDT12 Mouse Monoclonal Antibody [Clone ID: OTI1A2]

Sign In for Pricing
View Details
Tcf7 Rabbit Polyclonal Antibody
TA363009 100 µL

Tcf7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
4-Hydrazinobenzoic Acid Hydrochloride
TRC-H716575-250MG 250 mg

4-Hydrazinobenzoic Acid Hydrochloride

Sign In for Pricing
View Details
Clotrimazole-d5
TRC-C587402-1MG 1 mg

Clotrimazole-d5

Sign In for Pricing
View Details
Bucculite™ FdU Cu-Free Cell Proliferation Fluorescence Imaging Kit *Deep Red Fluorescence*
22320-AAT 200 Tests

Bucculite™ FdU Cu-Free Cell Proliferation Fluorescence Imaging Kit *Deep Red Fluorescence*

Sign In for Pricing
View Details
Col5a1 Mouse Gene Knockout Kit (CRISPR)
KN503643 1 Kit

Col5a1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details