Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBX20 Peptide - middle region

TBX20 Peptide - middle region

Product Specifications

Product Name Alternative

Tbx12, AL022859, 9430010M06Rik

UniProt

Q9ES03

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001192014.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LMDIVPVDNKRYRYAYHRSSWLVAGKADPPLPARLYVHPDSPFTGEQLLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diethyl 2-Hydroxypentanedioate (>90%)
TRC-D482740-10MG 10 mg

Diethyl 2-Hydroxypentanedioate (>90%)

Sign In for Pricing
View Details
Human IGFBPL1 activation kit by CRISPRa
GA117641 1 Kit

Human IGFBPL1 activation kit by CRISPRa

Sign In for Pricing
View Details
FAM13A (NM_001015045) Human Over-expression Lysate
LY423113 100 µg

FAM13A (NM_001015045) Human Over-expression Lysate

Sign In for Pricing
View Details
Benmijunzhi
TRC-B852360-500MG 500 mg

Benmijunzhi

Sign In for Pricing
View Details
CD8A Mouse Monoclonal Antibody [Clone ID: B-Z31]
AM31251AF-N 200 µg

CD8A Mouse Monoclonal Antibody [Clone ID: B-Z31]

Sign In for Pricing
View Details
GSK3 alpha (GSK3A) Rabbit Polyclonal Antibody
AP06151PU-N 100 µg

GSK3 alpha (GSK3A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details