Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANXA5 Peptide - C-terminal region

ANXA5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Anx5, R74653

UniProt

P48036

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_033803.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DDHTLIRVVVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFAT5 (NM_001113178) Human Over-expression Lysate
LY426386 100 µg

NFAT5 (NM_001113178) Human Over-expression Lysate

Sign In for Pricing
View Details
MPRA Antibody
8G388-AAT 50 µg

MPRA Antibody

Sign In for Pricing
View Details
CLOCK Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E12]
TA804781BM 100 µL

CLOCK Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E12]

Sign In for Pricing
View Details
JNK1 (MAPK8) pThr183 Rabbit Polyclonal Antibody
AP20849PU-N 100 µg

JNK1 (MAPK8) pThr183 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD134, Mouse (OX40) (OX-86), CF647 conjugate, 0.1mg/mL
BNC472004-100 1x 100 µL

CD134, Mouse (OX40) (OX-86), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RET Chicken Polyclonal Antibody
AP33454PU-N 100 µg

RET Chicken Polyclonal Antibody

Sign In for Pricing
View Details