Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANXA5 Peptide - C-terminal region

ANXA5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Anx5, R74653

UniProt

P48036

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_033803.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DDHTLIRVVVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Swine IL-17A protein (His Tag)
PKSS000009-01 5 µg

Recombinant Swine IL-17A protein (His Tag)

Sign In for Pricing
View Details
Recombinant Swine IL-17A protein (His Tag)
PKSS000009-02 20 µg

Recombinant Swine IL-17A protein (His Tag)

Sign In for Pricing
View Details
NMDAR2A (GRIN2A) Rabbit Monoclonal Antibody
TA423171 100 µL

NMDAR2A (GRIN2A) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CD59 / Complement Regulatory Protein / Protectin (MACIF/2867R), CF740 conjugate, 0.1mg/mL
BNC742867-100 1x 100 µL

CD59 / Complement Regulatory Protein / Protectin (MACIF/2867R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Reep6 Mouse Gene Knockout Kit (CRISPR)
KN514647 1 Kit

Reep6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
G protein coupled receptor 30 (GPER1) (NM_001505) Human Over-expression Lysate
LC419894 20 µg

G protein coupled receptor 30 (GPER1) (NM_001505) Human Over-expression Lysate

Sign In for Pricing
View Details