Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUP62 Peptide - middle region

NUP62 Peptide - middle region

Product Specifications

Product Name Alternative

P62, Nupc1, D7Ertd649e

UniProt

Q63850

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_444304.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FILSQQKELEDLLSPLEESVKEQSGTIYLQHADEEREKTYKLAENIDAQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2921), CF405S conjugate, 0.1mg/mL
BNC042921-500 1x 500 µL

Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2921), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Loganic Acid
TRC-L469408-2MG 2 mg

Loganic Acid

Sign In for Pricing
View Details
NR2E3 Mouse Monoclonal Antibody [Clone ID: OTI10C4]
CF806275 100 µg

NR2E3 Mouse Monoclonal Antibody [Clone ID: OTI10C4]

Sign In for Pricing
View Details
Phospho-MEK1 (S298) Recombinant Rabbit Monoclonal Antibody [SD206-7]
ET1612-40 100 µL

Phospho-MEK1 (S298) Recombinant Rabbit Monoclonal Antibody [SD206-7]

Sign In for Pricing
View Details
ANKRD36BP1 Antibody
KC-3152-01 50 μL

ANKRD36BP1 Antibody

Sign In for Pricing
View Details
ANKRD36BP1 Antibody
KC-3152-02 100 µL

ANKRD36BP1 Antibody

Sign In for Pricing
View Details