Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUP62 Peptide - middle region

NUP62 Peptide - middle region

Product Specifications

Product Name Alternative

P62, Nupc1, D7Ertd649e

UniProt

Q63850

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_444304.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FILSQQKELEDLLSPLEESVKEQSGTIYLQHADEEREKTYKLAENIDAQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEPN1 (SELENON) (C-term) Rabbit Polyclonal Antibody
AP53849PU-N 400 µL

SEPN1 (SELENON) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Abietic Acid, 75%
TRC-A108200-25G 25 g

Abietic Acid, 75%

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS700870 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
IFNA2 Antibody
KC-644-01 50 μL

IFNA2 Antibody

Sign In for Pricing
View Details
IFNA2 Antibody
KC-644-02 100 µL

IFNA2 Antibody

Sign In for Pricing
View Details
IFNA2 Antibody
KC-644-03 1 mL

IFNA2 Antibody

Sign In for Pricing
View Details