PPP6R3 Peptide - middle region
PPP6R3 Peptide - middle region
Product Specifications
Product Name Alternative
SAPL, PP6R3, SAPLa, SAPS3, SAP190, C11orf23
UniProt
Q5H9R7
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001157632.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FEPSSANTEDKMEVDLSEPPNWSANFDVPMETTHGAPLDSVGSDVWSTEE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bsm-62160R-BF750 100 µL
DDX17 Recombinant Antibody, AbBy Fluor™ 750 Conjugated
Sign In for Pricing
View Details 
129952-PE 100 µL
MTAP (methylthioadenosine phosphorylase, 5'-methylthioadenosine phosphorylase, c86fus, MSAP, MTAPase, MTA Phosphorylase, S-methyl-5'-thioadenosine Phosphorylase) (PE)
Sign In for Pricing
View Details