Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADCY5 Peptide - middle region

ADCY5 Peptide - middle region

Product Specifications

Product Name Alternative

AC5, FDFM

UniProt

O95622

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001186571.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIAN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBQLN1 Antibody, Biotin conjugated
MBS7051599-01 0.05 mg

UBQLN1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
UBQLN1 Antibody, Biotin conjugated
MBS7051599-02 0.1 mg

UBQLN1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
UBQLN1 Antibody, Biotin conjugated
MBS7051599-03 5x 0.1 mg

UBQLN1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
HPLC Column, Diol,3μm,120Å,2.1x30mm
13011799 1 PC

HPLC Column, Diol,3μm,120Å,2.1x30mm

Sign In for Pricing
View Details
Troponin I (HRP)
MBS6450424-01 0.1 mL

Troponin I (HRP)

Sign In for Pricing
View Details
Troponin I (HRP)
MBS6450424-02 5x 0.1 mL

Troponin I (HRP)

Sign In for Pricing
View Details