Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADCY5 Peptide - middle region

ADCY5 Peptide - middle region

Product Specifications

Product Name Alternative

AC5, FDFM

UniProt

O95622

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001186571.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIAN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OKRC00553-96W - IGFBP-4 ELISA Kit (Human)
OKRC00553-96W 96 Well

OKRC00553-96W - IGFBP-4 ELISA Kit (Human)

Sign In for Pricing
View Details
Mouse CCL25/TECK Recombinant Protein
PPT-16301 100 µg

Mouse CCL25/TECK Recombinant Protein

Sign In for Pricing
View Details
WNT16 293 Cell Lysate
406818 0.1 mg

WNT16 293 Cell Lysate

Sign In for Pricing
View Details
Neurofilament Antibody
orb1312045 100 µL

Neurofilament Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal PIP Antibody (SR1245)
NBP3-22064-50ul 50 µL

Rabbit Monoclonal PIP Antibody (SR1245)

Sign In for Pricing
View Details
Purified anti-mouse CD45.2
GT01880 500 µg

Purified anti-mouse CD45.2

Sign In for Pricing
View Details