Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFI1 Peptide - N-terminal region

GFI1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SCN2, GFI-1, GFI1A, ZNF163

UniProt

Q99684

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001120687.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAEPRDRLSPES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPKOW Antibody
OC-439-01 50 μL

GPKOW Antibody

Sign In for Pricing
View Details
GPKOW Antibody
OC-439-02 100 µL

GPKOW Antibody

Sign In for Pricing
View Details
GPKOW Antibody
OC-439-03 1 mL

GPKOW Antibody

Sign In for Pricing
View Details
Recombinant WNT7A Antibody
RN-018-01 50 μL

Recombinant WNT7A Antibody

Sign In for Pricing
View Details
Recombinant WNT7A Antibody
RN-018-02 100 µL

Recombinant WNT7A Antibody

Sign In for Pricing
View Details
Recombinant WNT7A Antibody
RN-018-03 1 mL

Recombinant WNT7A Antibody

Sign In for Pricing
View Details