Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFI1 Peptide - N-terminal region

GFI1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SCN2, GFI-1, GFI1A, ZNF163

UniProt

Q99684

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001120687.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAEPRDRLSPES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NucSpot® 594/615, 1000X in DMSO (trial size)
#41037-T 1x 20 µL

NucSpot® 594/615, 1000X in DMSO (trial size)

Sign In for Pricing
View Details
GKAP1 (NM_001135953) Human Over-expression Lysate
LC427741 20 µg

GKAP1 (NM_001135953) Human Over-expression Lysate

Sign In for Pricing
View Details
Celestolide
TRC-C253500-50MG 50 mg

Celestolide

Sign In for Pricing
View Details
SMARCA1 Human Gene Knockout Kit (CRISPR)
KN418308 1 Kit

SMARCA1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18/1190), CF640R conjugate, 0.1mg/mL
BNC401190-100 1x 100 µL

Cytokeratin 18 (KRT18/1190), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Testis
CS510203 5x 5 µm

Frozen Tissue Sections, Testis

Sign In for Pricing
View Details