Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGCR Peptide - C-terminal region

HMGCR Peptide - C-terminal region

Product Specifications

Product Name Alternative

LDLCQ3

UniProt

P04035

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000850.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEC14L4 Polyclonal Antibody, FITC Conjugated
bs-19610R-FITC 100 µL

SEC14L4 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Anti-mouse CD49d (Integrin alpha 4) SAFIRE Purified
MBS696943-01 0.1 mg

Anti-mouse CD49d (Integrin alpha 4) SAFIRE Purified

Sign In for Pricing
View Details
Anti-mouse CD49d (Integrin alpha 4) SAFIRE Purified
MBS696943-02 0.5 mg

Anti-mouse CD49d (Integrin alpha 4) SAFIRE Purified

Sign In for Pricing
View Details
Anti-mouse CD49d (Integrin alpha 4) SAFIRE Purified
MBS696943-03 5x 0.5 mg

Anti-mouse CD49d (Integrin alpha 4) SAFIRE Purified

Sign In for Pricing
View Details
Anti Complement Inhibitor (OmcI) Pab
272249 100 µg

Anti Complement Inhibitor (OmcI) Pab

Sign In for Pricing
View Details
INTS13 Rabbit Polyclonal Antibody (Fluoro550)
orb3091779 100 µg

INTS13 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details