Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGCR Peptide - C-terminal region

HMGCR Peptide - C-terminal region

Product Specifications

Product Name Alternative

LDLCQ3

UniProt

P04035

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000850.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRP2 (HDGFRP2) (NM_032631) Human Tagged ORF Clone Lentiviral Particle
RC218644L3V 200 µL

HRP2 (HDGFRP2) (NM_032631) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Biotinylated Human LILRA5 (C-6His-Avi)
32-11445-20 20 µg

Biotinylated Human LILRA5 (C-6His-Avi)

Sign In for Pricing
View Details
Compound 0118-0250
T131685-01 1 mg

Compound 0118-0250

Sign In for Pricing
View Details
Compound 0118-0250
T131685-02 5 mg

Compound 0118-0250

Sign In for Pricing
View Details
ERAS Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV622711 1.0 µg DNA

ERAS Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Chicken Anti-X-Prolyl Aminopeptidase 2, Membrane Bound antibody ELISA Kit
MBS7278409-01 48 Well

Chicken Anti-X-Prolyl Aminopeptidase 2, Membrane Bound antibody ELISA Kit

Sign In for Pricing
View Details