Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GTF2H1 Peptide - middle region

GTF2H1 Peptide - middle region

Product Specifications

Product Name Alternative

P62, BTF2, TFB1, TFIIH

UniProt

P32780

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001135779.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGKNNSVKTIALNLKKSDRYYHGPTPIQSLQYATSQDIINSFQSIRQEME

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calpain reg siRNA (h)
sc-29887 10 µM

Calpain reg siRNA (h)

Sign In for Pricing
View Details
Human INSL4 shRNA Plasmid
abx952441-01 150 µg

Human INSL4 shRNA Plasmid

Sign In for Pricing
View Details
Human INSL4 shRNA Plasmid
abx952441-02 300 µg

Human INSL4 shRNA Plasmid

Sign In for Pricing
View Details
BRE CRISPRa sgRNA lentivector (set of three targets)(Human)
13472121 3x 1.0µg DNA

BRE CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
PCIF1 CRISPR Knock Out 293T Cell Line (Human)
36197141 1x 10^6 Cells / 1.0 mL

PCIF1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
NIPBL CRISPR Knock Out 293T Cell Line (Human)
31851141 1x 10^6 Cells / 1.0 mL

NIPBL CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details