Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LPL Peptide - middle region

LPL Peptide - middle region

Product Specifications

Product Name Alternative

LIPD, HDLCQ11

UniProt

P06858

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000228.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YESWVPKLVAALYKREPDSNVIVVDWLSRAQEHYPVSAGYTKLVGQDVAR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VEGF-A Antibody
orb2704255-01 20 µg

VEGF-A Antibody

Sign In for Pricing
View Details
VEGF-A Antibody
orb2704255-02 100 µg

VEGF-A Antibody

Sign In for Pricing
View Details
NAT2, CT (N-acetyltransferase Type 2, NAT-2, Arylamine N-acetyltransferase 2, Arylamide Acetylase 2, AAC2, Polymorphic Arylamine N-acetyltransferase, PNAT)
MBS626733-01 0.2 mL

NAT2, CT (N-acetyltransferase Type 2, NAT-2, Arylamine N-acetyltransferase 2, Arylamide Acetylase 2, AAC2, Polymorphic Arylamine N-acetyltransferase, PNAT)

Sign In for Pricing
View Details
NAT2, CT (N-acetyltransferase Type 2, NAT-2, Arylamine N-acetyltransferase 2, Arylamide Acetylase 2, AAC2, Polymorphic Arylamine N-acetyltransferase, PNAT)
MBS626733-02 5x 0.2 mL

NAT2, CT (N-acetyltransferase Type 2, NAT-2, Arylamine N-acetyltransferase 2, Arylamide Acetylase 2, AAC2, Polymorphic Arylamine N-acetyltransferase, PNAT)

Sign In for Pricing
View Details
Beclin 1/BECN1 Rabbit Polyclonal Antibody
orb11649 100 µg

Beclin 1/BECN1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Insulin Promoter Factor 1 (IPF) ELISA Kit
orb781061-01 48 Tests

Mouse Insulin Promoter Factor 1 (IPF) ELISA Kit

Sign In for Pricing
View Details