Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LPL Peptide - middle region

LPL Peptide - middle region

Product Specifications

Product Name Alternative

LIPD, HDLCQ11

UniProt

P06858

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000228.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YESWVPKLVAALYKREPDSNVIVVDWLSRAQEHYPVSAGYTKLVGQDVAR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTF2A1 siRNA (Mouse)
orb1839115-01 15 nmol

GTF2A1 siRNA (Mouse)

Sign In for Pricing
View Details
GTF2A1 siRNA (Mouse)
orb1839115-02 30 nmol

GTF2A1 siRNA (Mouse)

Sign In for Pricing
View Details
BMPR1A Polyclonal Antibody Cy3 Conjugated
orb1542912 100 µL

BMPR1A Polyclonal Antibody Cy3 Conjugated

Sign In for Pricing
View Details
Recombinant Human FGF14 Isoform 1B protein (His tag)
PDEH100764-01 20 µg

Recombinant Human FGF14 Isoform 1B protein (His tag)

Sign In for Pricing
View Details
Recombinant Human FGF14 Isoform 1B protein (His tag)
PDEH100764-02 100 µg

Recombinant Human FGF14 Isoform 1B protein (His tag)

Sign In for Pricing
View Details
Recombinant Human FGF14 Isoform 1B protein (His tag)
PDEH100764-03 500 µg

Recombinant Human FGF14 Isoform 1B protein (His tag)

Sign In for Pricing
View Details