Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCT Peptide - middle region

SCT Peptide - middle region

Product Specifications

Product Name Alternative

Secr

UniProt

P11384

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_073161

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SFVLPAPPRTPRHSDGTFTSELSRLQDSARLQRLLQGLVGKRSEEDTENI

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF5 (NM_001969) Human Tagged Lenti ORF Clone
RC206301L4 10 µg

EIF5 (NM_001969) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Fatty Acid Synthase Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-54469R-BF680 100 µL

Fatty Acid Synthase Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
TBC1D1 Antibody
AF7909-01 50 µL

TBC1D1 Antibody

Sign In for Pricing
View Details
TBC1D1 Antibody
AF7909-02 100 µL

TBC1D1 Antibody

Sign In for Pricing
View Details
TBC1D1 Antibody
AF7909-03 200 µL

TBC1D1 Antibody

Sign In for Pricing
View Details
5-[ (4-Fluorophenyl) methoxy]-4-oxo-4H-pyran-2-carboxylic acid
QRB34899-01 100 mg

5-[ (4-Fluorophenyl) methoxy]-4-oxo-4H-pyran-2-carboxylic acid

Sign In for Pricing
View Details