SCT Peptide - middle region
SCT Peptide - middle region
Product Specifications
Product Name Alternative
Secr
UniProt
P11384
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_073161
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SFVLPAPPRTPRHSDGTFTSELSRLQDSARLQRLLQGLVGKRSEEDTENI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7026446-01 0.02 mg
Recombinant Escherichia coli Probable glycerol-3-phosphate acyltransferase (plsY)
Sign In for Pricing
View Details MBS7026446-02 0.1 mg
Recombinant Escherichia coli Probable glycerol-3-phosphate acyltransferase (plsY)
Sign In for Pricing
View Details MBS7026446-03 5x 0.1 mg
Recombinant Escherichia coli Probable glycerol-3-phosphate acyltransferase (plsY)
Sign In for Pricing
View Details OM618599 96 Strip Well
Bovine Cancer susceptibility candidate protein 1 (CASC1) ELISA Kit
Sign In for Pricing
View Details