Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATIC Peptide - middle region

ATIC Peptide - middle region

Product Specifications

UniProt

O35567

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_112276.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SYCVLQMDQSYKPDENEVRTLFGLRLSQKRNNGVVDKSLFSNIVTKNKDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gentamycin (Gentamicin) (MaxLight 550)
G2025-01-ML550 100 µL

Gentamycin (Gentamicin) (MaxLight 550)

Sign In for Pricing
View Details
ARHGAP17 Protein Vector (Mouse) (pPB-C-His)
PV155710 500 ng

ARHGAP17 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Xanthomonas campestris pv. campestris Membrane protein insertase YidC (yidC)
MBS7034904-01 0.02 mg

Recombinant Xanthomonas campestris pv. campestris Membrane protein insertase YidC (yidC)

Sign In for Pricing
View Details
Recombinant Xanthomonas campestris pv. campestris Membrane protein insertase YidC (yidC)
MBS7034904-02 0.1 mg

Recombinant Xanthomonas campestris pv. campestris Membrane protein insertase YidC (yidC)

Sign In for Pricing
View Details
Recombinant Xanthomonas campestris pv. campestris Membrane protein insertase YidC (yidC)
MBS7034904-03 5x 0.1 mg

Recombinant Xanthomonas campestris pv. campestris Membrane protein insertase YidC (yidC)

Sign In for Pricing
View Details
CD8 (Leu2 T lymphocyte antigen, MAL, OKT8 T Cell antigen, p32, T cell antigen Leu2, T cell surface glycoprotein CD8 alpha, Suppressor/Cytotoxic T cell) (Biotin)
C2259-08L 500 µg

CD8 (Leu2 T lymphocyte antigen, MAL, OKT8 T Cell antigen, p32, T cell antigen Leu2, T cell surface glycoprotein CD8 alpha, Suppressor/Cytotoxic T cell) (Biotin)

Sign In for Pricing
View Details