Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATIC Peptide - middle region

ATIC Peptide - middle region

Product Specifications

UniProt

O35567

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_112276.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SYCVLQMDQSYKPDENEVRTLFGLRLSQKRNNGVVDKSLFSNIVTKNKDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pipette tips racked TipBox 01- 20 ul BIO-CERT PP colorless
PIP4722 960 / PCK

Pipette tips racked TipBox 01- 20 ul BIO-CERT PP colorless

Sign In for Pricing
View Details
Lentiviral human SPOP shRNA (UAS) - Lentiviral human SPOP shRNA (UAS, RFP) plasmid
GTR15092773 1 Vial

Lentiviral human SPOP shRNA (UAS) - Lentiviral human SPOP shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
TMEM126B (NM_001193538) Human Over-expression Lysate
LS055863-100ug 100 µg

TMEM126B (NM_001193538) Human Over-expression Lysate

Sign In for Pricing
View Details
ACF1 Rabbit pAb, Pacific Blue conjugated
orb2864432 100 µL

ACF1 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
Anti-Human CD58/LFA3 Antibody (SAA0027), PE
FHD33012 100 Tests

Anti-Human CD58/LFA3 Antibody (SAA0027), PE

Sign In for Pricing
View Details
1700029J11Rik Recombinant Protein (Mouse)
RP110381 100 µg

1700029J11Rik Recombinant Protein (Mouse)

Sign In for Pricing
View Details