Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC26A6 Peptide - middle region

SLC26A6 Peptide - middle region

Product Specifications

UniProt

Q9BXS9

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001035544.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KMMQVSSGDKMEDATANGQEDSKAPDGSTLKALGLPQPDFHSLILDLGAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ubl4a Mouse shRNA Plasmid (Locus ID 27643)
TL510643 1 Kit

Ubl4a Mouse shRNA Plasmid (Locus ID 27643)

Sign In for Pricing
View Details
Listeria MONO Test
88010 20 Tests

Listeria MONO Test

Sign In for Pricing
View Details
Ubn2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6639106 1.0 µg DNA

Ubn2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Fancf sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3095806 1.0 µg DNA

Fancf sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Human sCD14 Antibody Pair Set
MBS2577648-01 1 Pair

Human sCD14 Antibody Pair Set

Sign In for Pricing
View Details
Human sCD14 Antibody Pair Set
MBS2577648-02 5x 1 Pair

Human sCD14 Antibody Pair Set

Sign In for Pricing
View Details