Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC26A6 Peptide - middle region

SLC26A6 Peptide - middle region

Product Specifications

UniProt

Q9BXS9

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001035544.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KMMQVSSGDKMEDATANGQEDSKAPDGSTLKALGLPQPDFHSLILDLGAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Gibberella zeae Mitochondrial import inner membrane translocase subunit TIM50 (TIM50), partial
MBS7079962 Inquire

Recombinant Gibberella zeae Mitochondrial import inner membrane translocase subunit TIM50 (TIM50), partial

Sign In for Pricing
View Details
AGXT Rabbit pAb
APA3587-01 30 µL

AGXT Rabbit pAb

Sign In for Pricing
View Details
AGXT Rabbit pAb
APA3587-02 50 μL

AGXT Rabbit pAb

Sign In for Pricing
View Details
AGXT Rabbit pAb
APA3587-03 100 µL

AGXT Rabbit pAb

Sign In for Pricing
View Details
Hamster Apolipoprotein C4 ELISA Kit
MBS026303-01 48 Well

Hamster Apolipoprotein C4 ELISA Kit

Sign In for Pricing
View Details
Hamster Apolipoprotein C4 ELISA Kit
MBS026303-02 96 Well

Hamster Apolipoprotein C4 ELISA Kit

Sign In for Pricing
View Details