What is the catalog number for GJB6 Peptide - C-terminal region?

The catalog number for GJB6 Peptide - C-terminal region is orb1997774.

What sizes are available for GJB6 Peptide - C-terminal region?

GJB6 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is GJB6 Peptide - C-terminal region in stock?

GJB6 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

GJB6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Cx30, AA958971, D14Bwg0506e

UniProt

P70689

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001010937.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ISASVICMLLNVAELCYLLLKLCFRRSKRTQAQRNHPNHALKESKQNEMN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HY-RS22966 1 Set

Ccl5 Rat Pre-designed siRNA Set A

Sign In for Pricing

View Details

orb218640-01 1 mg

ELOVL6 peptide

Sign In for Pricing

View Details

orb218640-02 5 mg

ELOVL6 peptide

Sign In for Pricing

View Details

NBP2-99556MFV500 0.1 mL

Rabbit Polyclonal Annexin A9 Antibody [mFluor Violet 500 SE]

Sign In for Pricing

View Details

RP151496 100 µg

MRPL17 Recombinant Protein (Mouse)

Sign In for Pricing

View Details

orb192656-01 50 μL

CCL28 Antibody

Sign In for Pricing

View Details