What is the catalog number for GJB6 Peptide - C-terminal region?

The catalog number for GJB6 Peptide - C-terminal region is orb1997774.

What sizes are available for GJB6 Peptide - C-terminal region?

GJB6 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is GJB6 Peptide - C-terminal region in stock?

GJB6 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

GJB6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Cx30, AA958971, D14Bwg0506e

UniProt

P70689

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001010937.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ISASVICMLLNVAELCYLLLKLCFRRSKRTQAQRNHPNHALKESKQNEMN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLB2078 96 Well

Bovine Fibulin 2, FBLN2 GENLISA ELISA

Sign In for Pricing

View Details

PVT13526 2 µg

pCMV-SPORT6-GPBP1L1 Plasmid

Sign In for Pricing

View Details

RC214101L2 10 µg

TSLP (NM_033035) Human Tagged Lenti ORF Clone

Sign In for Pricing

View Details

RG238878 10 µg

CNO6L (CNOT6L) (NM_001286790) Human Tagged ORF Clone

Sign In for Pricing

View Details

sc-414085-LAC-2 200 µL

KLHDC3 Lentiviral Activation Particles (h2)

Sign In for Pricing

View Details

orb3133679-01 50 mg

MPDC hydrochloride

Sign In for Pricing

View Details