Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL30 Peptide - C-terminal region

RPL30 Peptide - C-terminal region

Product Specifications

UniProt

P62889

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001156957.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIRSMPEQTGEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC100505841 (NM_001195535) Human Over-expression Lysate
LY433954 100 µg

LOC100505841 (NM_001195535) Human Over-expression Lysate

Sign In for Pricing
View Details
SCRT1 Human Gene Knockout Kit (CRISPR)
KN424589 1 Kit

SCRT1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
rac-Gamma-Nonanolactone
TRC-N649360-50G 50 g

rac-Gamma-Nonanolactone

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR561109 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
ZNF32 (NM_001005368) Human Over-expression Lysate
LC423703 20 µg

ZNF32 (NM_001005368) Human Over-expression Lysate

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human/Mouse CD44 Antibody[IM7]
E-AB-F1100UL-01 25 µg

Elab Fluor® 488 Anti-Human/Mouse CD44 Antibody[IM7]

Sign In for Pricing
View Details