YWHAE Peptide - C-terminal region
YWHAE Peptide - C-terminal region
Product Specifications
Product Name Alternative
AU019196
UniProt
P62259
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_033562.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEAL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K0604708 1.0 µg DNA
DISP1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
Sign In for Pricing
View Details 16496124 3x 1.0µg DNA
CNOT8 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
Sign In for Pricing
View Details 
MBS2037206-01 0.1 mL
Cy3-Linked Polyclonal Antibody to Interleukin 8 (IL8)
Sign In for Pricing
View Details MBS2037206-02 0.2 mL
Cy3-Linked Polyclonal Antibody to Interleukin 8 (IL8)
Sign In for Pricing
View Details MBS2037206-03 0.5 mL
Cy3-Linked Polyclonal Antibody to Interleukin 8 (IL8)
Sign In for Pricing
View Details MBS2037206-04 1 mL
Cy3-Linked Polyclonal Antibody to Interleukin 8 (IL8)
Sign In for Pricing
View Details