Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YWHAE Peptide - C-terminal region

YWHAE Peptide - C-terminal region

Product Specifications

Product Name Alternative

AU019196

UniProt

P62259

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_033562.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTPN22 Rabbit Polyclonal Antibody
orb865721 100 µg

PTPN22 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
3-ketoacyl-CoA thiolase, peroxisomal Antibody (Biotin)
orb3156731 100 µg

3-ketoacyl-CoA thiolase, peroxisomal Antibody (Biotin)

Sign In for Pricing
View Details
4-Nitroindan-1-one
OR111546 1 g

4-Nitroindan-1-one

Sign In for Pricing
View Details
Anti-Mouse GTF3C2 (KIAA0011), Rabbit Polyclonal
MKA0011 Inquire

Anti-Mouse GTF3C2 (KIAA0011), Rabbit Polyclonal

Sign In for Pricing
View Details
Mouse monoclonal RFC4 Antibody (OTI1A8)
NBP2-45946 0.1 mL

Mouse monoclonal RFC4 Antibody (OTI1A8)

Sign In for Pricing
View Details
Dihydroaeruginoic acid
D052-5MG 5 mg

Dihydroaeruginoic acid

Sign In for Pricing
View Details