Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAX1 Peptide - middle region

PAX1 Peptide - middle region

Product Specifications

Product Name Alternative

Un, wt, hbs, Pax-1, hunchback, undulated

UniProt

P09084

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032806.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLAQPGPYEASKQPPPQPALPYNHIYQYPYPSPVSPTGTKMGTHPGVPGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MDM2 pThr218 Rabbit Polyclonal Antibody
AP12905PU-N 400 µL

MDM2 pThr218 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NAPSIN A Recombinant Rabbit Monoclonal Antibody [PD01-30]
HA721218 100 µL

NAPSIN A Recombinant Rabbit Monoclonal Antibody [PD01-30]

Sign In for Pricing
View Details
SEC31A (NM_001077208) Human Over-expression Lysate
LC421386 20 µg

SEC31A (NM_001077208) Human Over-expression Lysate

Sign In for Pricing
View Details
LRIF1 Polyclonal Antibody
E-AB-52491-01 20 µL

LRIF1 Polyclonal Antibody

Sign In for Pricing
View Details
LRIF1 Polyclonal Antibody
E-AB-52491-02 60 µL

LRIF1 Polyclonal Antibody

Sign In for Pricing
View Details
LRIF1 Polyclonal Antibody
E-AB-52491-03 120 µL

LRIF1 Polyclonal Antibody

Sign In for Pricing
View Details