Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAX1 Peptide - middle region

PAX1 Peptide - middle region

Product Specifications

Product Name Alternative

Un, wt, hbs, Pax-1, hunchback, undulated

UniProt

P09084

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032806.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLAQPGPYEASKQPPPQPALPYNHIYQYPYPSPVSPTGTKMGTHPGVPGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Gamma-Glutamyltransferase 1 (gGT1) ELISA Kit
RD-gGT1-Hu-01 96 Tests

Human Gamma-Glutamyltransferase 1 (gGT1) ELISA Kit

Sign In for Pricing
View Details
Human Gamma-Glutamyltransferase 1 (gGT1) ELISA Kit
RD-gGT1-Hu-02 48 Tests

Human Gamma-Glutamyltransferase 1 (gGT1) ELISA Kit

Sign In for Pricing
View Details
Human SLC26A7 activation kit by CRISPRa
GA114509 1 Kit

Human SLC26A7 activation kit by CRISPRa

Sign In for Pricing
View Details
(-)-Maackiain
TRC-M214390-5MG 5 mg

(-)-Maackiain

Sign In for Pricing
View Details
XRCC4 Human Gene Knockout Kit (CRISPR)
KN204783BN 1 Kit

XRCC4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human AGBL2 activation kit by CRISPRa
GA112669 1 Kit

Human AGBL2 activation kit by CRISPRa

Sign In for Pricing
View Details