What is the catalog number for NEUROG2 Peptide - middle region?

The catalog number for NEUROG2 Peptide - middle region is orb1997767.

What sizes are available for NEUROG2 Peptide - middle region?

NEUROG2 Peptide - middle region is available in the following size(s): 100 µg.

Is NEUROG2 Peptide - middle region in stock?

NEUROG2 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

NEUROG2 Peptide - middle region

Product Specifications

Product Name Alternative

Ngn2, Atoh4, ngn-2, Math4A, bHLHa8

UniProt

P70447

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_033848.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E56G4431 100 µL

SSPN Rabbit Monoclonal Antibody

Sign In for Pricing

View Details

25177016 1.0 µg DNA

Itgb6 ORF Vector (Rat) (pORF)

Sign In for Pricing

View Details

ARP1011 1 Million

Human Bone Marrow Mononuclear Cells (BMMCs)

Sign In for Pricing

View Details

orb578642 100 µL

LIN7C Rabbit Polyclonal Antibody

Sign In for Pricing

View Details

orb839754 2 mg

RACK1B Antibody

Sign In for Pricing

View Details

E4262hu-01 48 Well

Human Chemokine (C-C motif) ligand 4, CCL4 ELISA KIT

Sign In for Pricing

View Details