NEUROG2 Peptide - middle region
NEUROG2 Peptide - middle region
Product Specifications
Product Name Alternative
Ngn2, Atoh4, ngn-2, Math4A, bHLHa8
UniProt
P70447
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_033848.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTKI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1208286-01 0.02 mg (E-Coli)
Recombinant Mouse Prolactin-7D1 (Prl7d1)
Sign In for Pricing
View Details MBS1208286-02 0.1 mg (E-Coli)
Recombinant Mouse Prolactin-7D1 (Prl7d1)
Sign In for Pricing
View Details MBS1208286-03 0.02 mg (Yeast)
Recombinant Mouse Prolactin-7D1 (Prl7d1)
Sign In for Pricing
View Details MBS1208286-04 0.1 mg (Yeast)
Recombinant Mouse Prolactin-7D1 (Prl7d1)
Sign In for Pricing
View Details MBS1208286-05 0.02 mg (Baculovirus)
Recombinant Mouse Prolactin-7D1 (Prl7d1)
Sign In for Pricing
View Details MBS1208286-06 0.02 mg (Mammalian-Cell)
Recombinant Mouse Prolactin-7D1 (Prl7d1)
Sign In for Pricing
View Details