HSPH1 Peptide - middle region
HSPH1 Peptide - middle region
Product Specifications
Product Name Alternative
105kDa, Hsp105, Hsp110, hsp-E7I, AI790491, hsp110/105
UniProt
Q61699
Field of Research
Cancer Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001334463.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KLKKLMSSNSTDLPLNIECFMNDKDVSGKMNRSQFEELCAELLQKIEVPL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
ARG1668 12 / PCK
Cardboard Dividers 49-Place for 2 or 3 Boxes - PK12
Sign In for Pricing
View Details 
MBS2137659-01 0.1 mL
APC Linked Monoclonal Antibody to Beclin 1 (BECN1)
Sign In for Pricing
View Details MBS2137659-02 0.2 mL
APC Linked Monoclonal Antibody to Beclin 1 (BECN1)
Sign In for Pricing
View Details MBS2137659-03 0.5 mL
APC Linked Monoclonal Antibody to Beclin 1 (BECN1)
Sign In for Pricing
View Details MBS2137659-04 1 mL
APC Linked Monoclonal Antibody to Beclin 1 (BECN1)
Sign In for Pricing
View Details