Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM21 Peptide - C-terminal region

TRIM21 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Ro52, Ssa1

UniProt

Q62191

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPCQIGIFVDYEAGVVSFYNITDHGSLIYTFSECVFAGPLRPFFNVGFNY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Rectum
CR561604 5 µg

Tissue Total RNA, Rectum

Sign In for Pricing
View Details
6-Ethyl-4-[4-(1,3,4-thiadiazol-2-yl)-1-piperazinyl]thieno[2,3-d]pyrimidine Hydrochloride
TRC-E926745-10MG 10 mg

6-Ethyl-4-[4-(1,3,4-thiadiazol-2-yl)-1-piperazinyl]thieno[2,3-d]pyrimidine Hydrochloride

Sign In for Pricing
View Details
Oryzalin-D14
TRC-O848231-25MG 25 mg

Oryzalin-D14

Sign In for Pricing
View Details
Beta Amyloid 1-42 Antibody
KC-630-01 50 μL

Beta Amyloid 1-42 Antibody

Sign In for Pricing
View Details
Beta Amyloid 1-42 Antibody
KC-630-02 100 µL

Beta Amyloid 1-42 Antibody

Sign In for Pricing
View Details
Beta Amyloid 1-42 Antibody
KC-630-03 1 mL

Beta Amyloid 1-42 Antibody

Sign In for Pricing
View Details