Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM21 Peptide - C-terminal region

TRIM21 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Ro52, Ssa1

UniProt

Q62191

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPCQIGIFVDYEAGVVSFYNITDHGSLIYTFSECVFAGPLRPFFNVGFNY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMB7 Rabbit Polyclonal Antibody
HA500345 100 µL

PSMB7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CCR7 (NM_001838) Human Over-expression Lysate
LY419718 100 µg

CCR7 (NM_001838) Human Over-expression Lysate

Sign In for Pricing
View Details
CACNA1I Human Gene Knockout Kit (CRISPR)
KN419179 1 Kit

CACNA1I Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EED Antibody
KC-1046-01 50 μL

EED Antibody

Sign In for Pricing
View Details
EED Antibody
KC-1046-02 100 µL

EED Antibody

Sign In for Pricing
View Details
EED Antibody
KC-1046-03 1 mL

EED Antibody

Sign In for Pricing
View Details