STC1 Peptide - middle region
STC1 Peptide - middle region
Product Specifications
Product Name Alternative
Stc
UniProt
O55183
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_033311.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRG
More Discoveries
Explore Other Products
Browse additional items from our catalog
TP323551 20 µg
Histone H2A Bbd (H2AFB2) (NM_001017991) Human Recombinant Protein
Sign In for Pricing
View Details 
MP0171X Each
Magic™ Membrane Protein Human CCR5 (C-C motif chemokine receptor 5) with GST-tag for Antibody Discovery
Sign In for Pricing
View Details YP-W11022-01 48 Tests
Human phosphorylated Signal Transducer And Activator Of Transcription 1 (p-STAT1) ELISA Kit
Sign In for Pricing
View Details YP-W11022-02 96 Tests
Human phosphorylated Signal Transducer And Activator Of Transcription 1 (p-STAT1) ELISA Kit
Sign In for Pricing
View Details