Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADORA2A Peptide - middle region

ADORA2A Peptide - middle region

Product Specifications

Product Name Alternative

A2aR, A2AAR, AA2AR

UniProt

Q60613

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_033760.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PFIYAYRIREFRQTFRKIIRTHVLRRQEPFRAGGSSAWALAAHSTEGEQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Twist (Ser68) Antibody [M15K16]
C21672-50uL 50 μL

Phospho-Twist (Ser68) Antibody [M15K16]

Sign In for Pricing
View Details
Histone H3 (acetyl K27) Rabbit Polyclonal Antibody (BF405)
orb1603358 100 µL

Histone H3 (acetyl K27) Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Recombinant Borrelia burgdorferi Outer surface 22 kDa lipoprotein (p22)
MBS1208549-01 0.02 mg (E-Coli)

Recombinant Borrelia burgdorferi Outer surface 22 kDa lipoprotein (p22)

Sign In for Pricing
View Details
Recombinant Borrelia burgdorferi Outer surface 22 kDa lipoprotein (p22)
MBS1208549-02 0.1 mg (E-Coli)

Recombinant Borrelia burgdorferi Outer surface 22 kDa lipoprotein (p22)

Sign In for Pricing
View Details
Recombinant Borrelia burgdorferi Outer surface 22 kDa lipoprotein (p22)
MBS1208549-03 0.02 mg (Yeast)

Recombinant Borrelia burgdorferi Outer surface 22 kDa lipoprotein (p22)

Sign In for Pricing
View Details
Recombinant Borrelia burgdorferi Outer surface 22 kDa lipoprotein (p22)
MBS1208549-04 0.1 mg (Yeast)

Recombinant Borrelia burgdorferi Outer surface 22 kDa lipoprotein (p22)

Sign In for Pricing
View Details