Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADORA2A Peptide - middle region

ADORA2A Peptide - middle region

Product Specifications

Product Name Alternative

A2aR, A2AAR, AA2AR

UniProt

Q60613

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_033760.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PFIYAYRIREFRQTFRKIIRTHVLRRQEPFRAGGSSAWALAAHSTEGEQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H-Cys (Acm) -2-CT Polystyrene Resin
H0751503307.5G 5 g

H-Cys (Acm) -2-CT Polystyrene Resin

Sign In for Pricing
View Details
Polystyrene Weinreb AM Resin
H10060.25G 25 g

Polystyrene Weinreb AM Resin

Sign In for Pricing
View Details
Elab Fluor® 647 Rat IgG1, κ Isotype Control[HRPN]
E-AB-F09823M-01 25 µg

Elab Fluor® 647 Rat IgG1, κ Isotype Control[HRPN]

Sign In for Pricing
View Details
Elab Fluor® 647 Rat IgG1, κ Isotype Control[HRPN]
E-AB-F09823M-02 100 µg

Elab Fluor® 647 Rat IgG1, κ Isotype Control[HRPN]

Sign In for Pricing
View Details
Cytokeratin 10 (LH2), CF405S conjugate, 0.1mg/mL
BNC040674-500 1x 500 µL

Cytokeratin 10 (LH2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2152), CF488A conjugate, 0.1mg/mL
BNC882152-100 1x 100 µL

TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2152), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details