Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEIS2 Peptide - middle region

MEIS2 Peptide - middle region

Product Specifications

Product Name Alternative

Mrg1, Stra10, A430109D20Rik

UniProt

P97367

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001129544.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Copine family member IX
311794 100 µL

Copine family member IX

Sign In for Pricing
View Details
Conjugated GR Rabbit mAb
C59236 100 µL

Conjugated GR Rabbit mAb

Sign In for Pricing
View Details
HELIX-? (Type ? Collagen Helical Peptide) Rabbit ELISA Kit
D9702 96 Tests

HELIX-? (Type ? Collagen Helical Peptide) Rabbit ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) UBI4 Polyclonal Antibody
MBS7151290 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) UBI4 Polyclonal Antibody

Sign In for Pricing
View Details
Cinnamyl acetate
HY-N7125-01 100 g

Cinnamyl acetate

Sign In for Pricing
View Details
Cinnamyl acetate
HY-N7125-02 10 mM - 1 mL

Cinnamyl acetate

Sign In for Pricing
View Details