Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEIS2 Peptide - middle region

MEIS2 Peptide - middle region

Product Specifications

Product Name Alternative

Mrg1, Stra10, A430109D20Rik

UniProt

P97367

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001129544.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Bromo adjacent homology domain containing 1 protein (BAHD1) ELISA Kit
GTR10321307 96 Well

Monkey Bromo adjacent homology domain containing 1 protein (BAHD1) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Integrin alpha-V Protein, His, Yeast-1mg
QP9224-ye-1mg 1mg

Recombinant Human Integrin alpha-V Protein, His, Yeast-1mg

Sign In for Pricing
View Details
Rat ERBB3/HER3 Protein, Fc Tag
PR215 50 µg

Rat ERBB3/HER3 Protein, Fc Tag

Sign In for Pricing
View Details
3',5'-Di-O-acetyl-2'-deoxy-2'-fluorouridine
TRC-D422508-50MG 50 mg

3',5'-Di-O-acetyl-2'-deoxy-2'-fluorouridine

Sign In for Pricing
View Details
Cysteic Acid
RG-C251901-01 10 mg

Cysteic Acid

Sign In for Pricing
View Details
Cysteic Acid
RG-C251901-02 25 mg

Cysteic Acid

Sign In for Pricing
View Details