Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINB2 Peptide - C-terminal region

SERPINB2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PAI-2, Planh2, ovalbumin

UniProt

P12388

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001167641.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LFLSEVFHQASVDVTEEGTVAAGGTGAVMTGRTGHGGPQFVADHPFLFFI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR73A (PROKR1) (NM_138964) Human Over-expression Lysate
LC403372 20 µg

GPR73A (PROKR1) (NM_138964) Human Over-expression Lysate

Sign In for Pricing
View Details
Vmn1r19 Mouse Gene Knockout Kit (CRISPR)
KN518981 1 Kit

Vmn1r19 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS704774 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
HDAC4 (194-209) Rabbit Polyclonal Antibody
AP08440PU-N 50 µg

HDAC4 (194-209) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Carbonic Anhydrase IX/CA9 Monoclonal Antibody
AN300177P-01 20 µL

Recombinant Carbonic Anhydrase IX/CA9 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Carbonic Anhydrase IX/CA9 Monoclonal Antibody
AN300177P-02 100 µL

Recombinant Carbonic Anhydrase IX/CA9 Monoclonal Antibody

Sign In for Pricing
View Details