Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINB2 Peptide - C-terminal region

SERPINB2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PAI-2, Planh2, ovalbumin

UniProt

P12388

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001167641.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LFLSEVFHQASVDVTEEGTVAAGGTGAVMTGRTGHGGPQFVADHPFLFFI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD68 (KP1), CF740 conjugate, 0.1mg/mL
BNC740512-500 1x 500 µL

CD68 (KP1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AMBP Rabbit Polyclonal Antibody
ER1803-35 100 µL

AMBP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bis(2-ethylhexyl)adipate
TRC-B433810-250G 250 g

Bis(2-ethylhexyl)adipate

Sign In for Pricing
View Details
Cenps Mouse Gene Knockout Kit (CRISPR)
KN501399 1 Kit

Cenps Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Colloidal Gold Labeled Neomycin HRP, 1mL 20nm
GH-02-20 1 mL

Colloidal Gold Labeled Neomycin HRP, 1mL 20nm

Sign In for Pricing
View Details
Dansyl Ethylenediamine
TRC-D179500-250MG 250 mg

Dansyl Ethylenediamine

Sign In for Pricing
View Details